| Bioactivity | [K15,R16,L27]VIP(1-7)/GRF(8-27), a VIP1 selective agonist, exhibits IC50 values of binding of 2 nM, 1 nM, 30,000 nM for the human VIP1, rat VIP1, rat VIP2 receptors, respectively[1]. VIP: VASOACTIVE Intestinal Polypeptide. |
| Name | [K15,R16,L27]VIP(1-7)/GRF(8-27) |
| CAS | 201995-58-6 |
| Sequence | His-Ser-Asp-Ala-Val-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Lys-Arg-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-NH2 |
| Shortening | HSDAVFTNSYRKVLKRLSARKLLQDIL-NH2 |
| Formula | C142H240N44O38 |
| Molar Mass | 3171.70 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. P Gourlet, et al. Development of high affinity selective VIP1 receptor agonists. Peptides. 1997;18(10):1539-45. |
[K15,R16,L27]VIP(1-7)/GRF(8-27)
CAS: 201995-58-6 F: C142H240N44O38 W: 3171.70
VIP(1-7)/GRF(8-27), a VIP1 selective agonist, exhibits IC50 values of binding of 2 nM, 1 nM, 30,000 nM forthe human VIP1
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.